PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G097900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NF-YB
Protein Properties Length: 167aa    MW: 17800.9 Da    PI: 7.62
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G097900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB178.75.4e-5620112193
               NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 
                         vreqdrflPian+srimkk++Pan+ki+kdaket+qecvsefisfvtseasdkcq+ekrkting+dllwa+atlGfe+yv+plk+yl+kyr
  Brast01G097900.1.p  20 VREQDRFLPIANISRIMKKAVPANGKIAKDAKETLQECVSEFISFVTSEASDKCQKEKRKTINGEDLLWAMATLGFEEYVDPLKIYLHKYR 110
                         69***************************************************************************************** PP

               NF-YB  92 el 93 
                         + 
  Brast01G097900.1.p 111 DG 112
                         85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.0E-5219122IPR009072Histone-fold
SuperFamilySSF471133.11E-3923118IPR009072Histone-fold
PfamPF008086.5E-292690IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.6E-225472No hitNo description
PROSITE patternPS0068505773IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006153.6E-227391No hitNo description
PRINTSPR006153.6E-2292110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MADGGSHDSG SPRGGGGGGV REQDRFLPIA NISRIMKKAV PANGKIAKDA KETLQECVSE  60
FISFVTSEAS DKCQKEKRKT INGEDLLWAM ATLGFEEYVD PLKIYLHKYR DGDSKLTSKS  120
GDGSVKKDTI GAHGGASSSN AQAMVQHGAY PQGMGYMQPQ YHNGDT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A2e-4819111193NF-YB
4awl_B2e-4819111294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A2e-4819111294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0944620.0FP094462.1 Phyllostachys edulis cDNA clone: bphyst012k19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564550.11e-113PREDICTED: nuclear transcription factor Y subunit B-3
RefseqXP_010232523.11e-113PREDICTED: nuclear transcription factor Y subunit B-3
SwissprotQ5QMG31e-93NFYB2_ORYSJ; Nuclear transcription factor Y subunit B-2
TrEMBLA0A0Q3GHB31e-121A0A0Q3GHB3_BRADI; Uncharacterized protein
STRINGBRADI2G54200.11e-113(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38880.72e-64nuclear factor Y, subunit B1